PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn016511
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 916aa    MW: 101097 Da    PI: 7.6323
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn016511genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP40.29e-13145174130
                 --SSTT-----TT--HHHHHTT--HHHHT- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhska 30 
                 +Cqv++C++dls+ak+yhrrhkvCevhsk+
  Achn016511 145 MCQVDNCREDLSNAKDYHRRHKVCEVHSKS 174
                 6***************************97 PP

2SBP31.25.8e-101741995378
                 TT--SS--S-STTTT-------S--- CS
         SBP  53 sefDeekrsCrrrLakhnerrrkkqa 78 
                 s+fDe+krsCrrrLa+hn+rrrk+q+
  Achn016511 174 SKFDEGKRSCRRRLAGHNRRRRKSQT 199
                 68*********************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.9E-13140174IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.272143197IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-21144200IPR004333Transcription factor, SBP-box
PfamPF031101.2E-7146174IPR004333Transcription factor, SBP-box
SuperFamilySSF484037.31E-6707808IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 916 aa     Download sequence    Send to blast
MEEVGAQVAP PIFMHQNLGG RFCEGHSMTK KRGQPNFHHQ QPRLTSGYGW NPNGWDWDSV  60
RFVAKPLESD VLCLGTARSF QSEQQRTSDE EVSGVPTSLE KNSVVDDDES LRLKLGGSLN  120
SSEEPMSKPN KRVRSGSPGG GNYPMCQVDN CREDLSNAKD YHRRHKVCEV HSKSKFDEGK  180
RSCRRRLAGH NRRRRKSQTE DVSSRILLSG NHSSHNGDLD IVNLLTVLAQ AQGHKEVKST  240
NCSTLPNKDH LLQIISKINS LPLPVDIEAK LPAPGSLSKT VPEQASSDNQ IRLNANTPSS  300
STKDLLAVLS ATLASPSPNA LAILSQRSSQ GVDADDTKLA CLDQALSLNM QNGAALQFPS  360
VGGERSSTSY QSPVEDSDCQ VQETRTNLPL QLFSSSREDG SPPKLACARK YFSSDSSNAI  420
EDSSPSSSPP VAQKLFPMQT TRETEPKRLS TGRKNAYVET SKAQGCVTSL ELFGLSHRGA  480
DNSSFQSLPY QAGYTSSSGS DHSPSSLNSD AQDRTGRMIF KLFGKNPSQL PETLRTQIYN  540
WLSHSPSEME SYIRPGCVIL SIYLSMTYSA WEQVENGFKG TSFPVIIADA TICKELRLLE  600
SEFGEGAKVH DTISEEQIHD FGQPQSKEEV LHFLNELGWL FQRKRNSSTF DTPNYTLARF  660
KFLFLFSVER NCCALVKTLL DILLERDLHR GEPSKESLDM LSEIHLLNRA VKRRCKNMVD  720
LLIHYPVPSG DDTLKYIFPP NLVGPGGVTP LHLAACTSSS DDVVDALTGD PQEIGLHCWN  780
SLLDTNGLSP YAYALMRNNH SYNRLVARKL ADRKNGQVSV SVATEIETQW SGMSQDHHPR  840
PLFKQGQKSC SKCAVVASRY NRRIPVSQGF LHQSYMLSML AVAAVCVCVC LFLRGHPDVG  900
LVAPFRWENL GYGPS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-17136196184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1708713RAVKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002273784.10.0PREDICTED: squamosa promoter-binding-like protein 14 isoform X2
SwissprotQ8RY951e-157SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A118K4I20.0A0A118K4I2_CYNCS; Ankyrin repeat-containing protein
STRINGVIT_18s0122g00380.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA128871219
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.11e-127squamosa promoter binding protein-like 14